
Tesamorelin
$59.99
Available
- Selected format
- 5 mg
- Documentation
- No report linked
- Preparation
- 1–3 business days
- Shipping
- $7.00 · Free $150+

- Order preparation
- 1–3 business days
- Estimated transit
- 3–7 business days
- Shipping & tracking
- $7.00, or free at $150. Tracking appears in your account after carrier acceptance.
Automatic bundle pricing
Best eligible price appliesMix formats · 5–10% off. Best eligible offer applies automatically.
| Compound | Tesamorelin |
|---|---|
| Amount | 5 mg |
| SKU | PL-TESAMORELIN-05 |
Product overview
About this research material
Tesamorelin is a peptide reference material. This listing covers 5 mg, 10 mg, and 20 mg formats and presents the compound identity, listed amounts, SKUs, and the independent laboratory report available for the documented 10 mg format. It is intended only for controlled laboratory research and is not for human or veterinary use.
Compound identity
- Display name
- Tesamorelin
- Alternate names
- TH9507, TH-9507
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- PubChem CID
- 16137828
- CAS number
- 218949-48-5
Product documents
Independent laboratory reports
Public source reports associated with Tesamorelin. These are reference documents and are not presented as batch-specific Vyse Labs Certificates of Analysis. Current and previous reports are retained below, newest first.
- Current report
10 mg Laboratory report
Janoshik Analytical
- Tesamorelin
- 10.55 mg
- Purity
- 99.372%
- Report
- 152644 / N3ZD4G7XHWN1
- Report date
- 29 April 2026
10 mg format reference; no Vyse Labs batch or lot is assigned.
Values are transcribed from the linked laboratory report without rounding.
Research use only
For laboratory research use only. Not for human or veterinary use, and not for use in diagnostic procedures.
- Not for human consumption or administration.
- Not for veterinary use.
- Not for use in diagnostic procedures.
- Not a drug, dietary supplement, food, or cosmetic.
Explore the catalogue
Related research materials
View all products →Questions about this product? support@vyselabs.co
